PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12997_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 345aa    MW: 39427.1 Da    PI: 8.2949
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12997_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.44.5e-2272131357
                  --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  +R+++t++ql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e++
  RrC12997_p1  72 SRWNPTPDQLKALEELYQQgTRTPSADHIQQITAQLrrygKIEGKNVFYWFQNHKARERQ 131
                  7*****************99**************************************97 PP

2Wus_type_Homeobox115.33e-3771133365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Ptp+Q+k Leely++G+rtP++++iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
        RrC12997_p1  71 SSRWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKR 133
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003898.3E-669136IPR001356Homeobox domain
SuperFamilySSF466891.14E-1271138IPR009057Homeodomain-like
PfamPF000468.7E-2072131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-972131IPR009057Homeodomain-like
CDDcd000862.22E-673133No hitNo description
PROSITE profilePS5007110.98177132IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MWMMGYNEGG ADSFDGGRKL RPLIPRLSSC PTAANSDHRF NMVMTTMTAE QNKRELMMLN  60
SEPQHPPLMV SSRWNPTPDQ LKALEELYQQ GTRTPSADHI QQITAQLRRY GKIEGKNVFY  120
WFQNHKARER QKRRRQMENV TTTSLVSNHG FDKKYPPSYK VEQTKNWICS VGCDIQPKKP  180
HDPNHQEEPI SIAMVATKRN GRHVGDERQN FPGRNAMSQM MQLAPGHYPS SQQQQQQQHH  240
QLILNSTTVS SNFSTSNSTV SAAKDTVTVS PLFLRTGAAT NTGTCDDNKD EERREDCLNG  300
EVDHQEQTLE LFPLRKEGFC NNGRDDGKEK ESGPHCFYEF LPLKN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513941e-125AY251394.1 Arabidopsis thaliana WOX1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013718706.10.0PREDICTED: WUSCHEL-related homeobox 1-like
RefseqXP_013639982.10.0PREDICTED: WUSCHEL-related homeobox 1-like
RefseqXP_013584234.10.0PREDICTED: WUSCHEL-related homeobox 1 isoform X2
SwissprotQ6X7K00.0WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A078JGB90.0A0A078JGB9_BRANA; BnaCnng51820D protein
STRINGBra022267.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73972741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-174WUSCHEL related homeobox 1